A kinesin-3 recruitment complex facilitates axonal sorting of enveloped alpha herpesvirus capsids
Authors:
Julian Scherer aff001; Ian B. Hogue aff002; Zachary A. Yaffe aff003; Nikhila S. Tanneti aff001; Benjamin Y. Winer aff001; Michael Vershinin aff004; Lynn W. Enquist aff001
Authors place of work:
Department of Molecular Biology and Princeton Neuroscience Institute, Princeton University, Princeton, New Jersey, United States of America
aff001; Center for Immunotherapy, Vaccines, and Virotherapy, Biodesign Institute & School of Life Sciences, Arizona State University, Tempe, Arizona, United States of America
aff002; University of Washington, Seattle, Washington, United States of America
aff003; Department of Physics and Astronomy, University of Utah, Salt Lake City, Utah, United States of America
aff004
Published in the journal:
A kinesin-3 recruitment complex facilitates axonal sorting of enveloped alpha herpesvirus capsids. PLoS Pathog 16(1): e32767. doi:10.1371/journal.ppat.1007985
Category:
Research Article
doi:
https://doi.org/10.1371/journal.ppat.1007985
Summary
Axonal sorting, the controlled passage of specific cargoes from the cell soma into the axon compartment, is critical for establishing and maintaining the polarity of mature neurons. To delineate axonal sorting events, we took advantage of two neuroinvasive alpha-herpesviruses. Human herpes simplex virus 1 (HSV-1) and pseudorabies virus of swine (PRV; suid herpesvirus 1) have evolved as robust cargo of axonal sorting and transport mechanisms. For efficient axonal sorting and subsequent egress from axons and presynaptic termini, progeny capsids depend on three viral membrane proteins (Us7 (gI), Us8 (gE), and Us9), which engage axon-directed kinesin motors. We present evidence that Us7-9 of the veterinary pathogen pseudorabies virus (PRV) form a tripartite complex to recruit Kif1a, a kinesin-3 motor. Based on multi-channel super-resolution and live TIRF microscopy, complex formation and motor recruitment occurs at the trans-Golgi network. Subsequently, progeny virus particles enter axons as enveloped capsids in a transport vesicle. Artificial recruitment of Kif1a using a drug-inducible heterodimerization system was sufficient to rescue axonal sorting and anterograde spread of PRV mutants devoid of Us7-9. Importantly, biophysical evidence suggests that Us9 is able to increase the velocity of Kif1a, a previously undescribed phenomenon. In addition to elucidating mechanisms governing axonal sorting, our results provide further insight into the composition of neuronal transport systems used by alpha-herpesviruses, which will be critical for both inhibiting the spread of infection and the safety of herpesvirus-based oncolytic therapies.
Keywords:
Pathogen motility – Vesicles – Neurons – Motor proteins – Kinesins – Axons – Capsids – Axonal transport
Introduction
Neuronal cells establish and maintain polarity between the somatodendritic and axonal compartments via selective microtubule (MT)-based vesicle transport [1–3]. Vesicles are propelled by opposing motor proteins of the cytoplasmic dynein and kinesin families towards either the MT minus ends or plus ends, respectively [4]. The microtubules in axons are oriented predominantly with plus ends towards the axon terminus [5], and kinesin motors generally move cargoes in the anterograde direction, towards the plus end [6]. Therefore, kinesin motors are thought to play a dominant role in sorting cargoes for axonal transport. Genetic screens have identified some of the kinesins that selectively transport cargoes across the axon initial segment (AIS) and into the axon [7]. However, it is currently unknown what roles different kinesins, opposing dynein motors, MT modifications, MT-associated proteins, and the physical restrictions imposed by the actin-rich structure of the AIS play in axonal sorting processes [8–10]. In this report, we studied the alpha-herpesviruses herpes simplex virus 1 (HSV-1) and pseudorabies virus (PRV; suid herpesvirus 1), robust cargos of MT-dependent vesicular axonal transport [11–13]. PRV particle egress is a complex, multi-step process [14–16]: new progeny capsids are assembled inside the nucleus, cross the bilayers of the nuclear envelope, and gain access to the cytoplasm as unenveloped particles. In the cell bodies, these particles are transported towards the trans-Golgi network (TGN), where they complete assembly of the viral tegument protein layer and acquire a double membrane by budding into an intracellular vesicle. The outer vesicle membrane is shed during the process of exocytosis at the plasma membrane, and the inner membrane serves as the virion envelope that mediates cell entry during the next infectious cycle. Importantly, egress vesicles must have the ability to interact with plus end-directed kinesin motors to move to the plasma membrane, in both neurons and non-neuronal cells. A subset of these vesicles recruits the kinesin-3 motor, Kif1a, to be sorted into the axon, cross the AIS, and move inside the axon towards distal egress sites [17, 18]. We recently described that newly assembled PRV particles in egress vesicles appear to move exclusively in the anterograde direction in axons, a behavior distinct from all other known axonal cargoes [13]. Three PRV proteins encoded in a gene cluster (Us7 (glycoprotein I; gI), Us8 (glycoprotein E; gE), and Us9) are required for axonal sorting, and appear to function by recruiting Kif1a to the axonal egress vesicle [17, 19, 20]. Us7 and Us8 encode for glycosylated multifunctional PRV membrane proteins with large cytoplasmic and ecto-domains [21]. Non-glycosylated Us9 is a small type II membrane protein that appears to function specifically in particle sorting and transport in neurons [22–25]. These proteins are also conserved with HSV-1, where they play similar, but possibly non-identical, roles in kinesin motor recruitment.
Here, we use biochemical, biophysical, and microscopic techniques to determine how PRV Us7-9 proteins form a tripartite Kif1a recruitment complex and demonstrate that Kif1a recruitment to virion transport vesicles is sufficient for axonal sorting and transport. Through comparisons of PRV with HSV-1, we show that both viruses co-transport with Kif1a in our model system and that PRV does not co-transport with the kinesin-1 motor Kif5b. This study contributes to our understanding of the basic cell biology of axonal sorting and transport, host-virus interactions in the nervous system, as well as practical knowledge for the design of better therapeutic antiviral agents, vaccines, and herpesvirus-based gene therapy and oncolytic virotherapeutics.
Results
Anterograde spread efficiency of PRV US7-9 mutants and trans-complementation
We used a well-established in vitro assay of axonal sorting and subsequent anterograde spread of PRV from cultured neurons to epithelial cells [26]. Primary rat superior cervical ganglia (SCG) neurons were cultured for two weeks in modified Campenot tri-chamber rings to separate cell bodies (soma compartment, S) from axon termini (neurite compartment, N) and virus-amplifying transformed epithelial indicator cells (Fig 1A). To compare the influence of Us7, Us8, and Us9 on axonal sorting, transport and defects in kinesin motor recruitment, we infected the neuronal cell bodies with a panel of PRV mutant viruses and measured plaque-forming titer in the S and N compartments at 24h post-infection (hpi). Titers of S compartment lysates showed robust neuronal replication for all tested mutants (Fig 1B–1F). In parallel, titers of lysates of the epithelial cells in the N compartment represented the extent of anterograde axon-to-cell spread. For all PRV mutants, we also measured functional trans-complementation by transducing SCG neurons prior to PRV infection with non-replicating adenovirus vectors (AdV) encoding wild-type PRV proteins. The N compartment titer of PRV mutants lacking Us7 (ΔUs7) was 3.5 log units lower than the wild type titer (Fig 1 B). The ΔUs7-CT deletion mutant had a similar spread defect suggesting that the cytoplasmic C-terminal domain (CT) was required for efficient spread. Expressing wild-type Us7 via AdV transduction prior to infection fully rescued the ΔUs7-CT spread defect, and partially rescued the ΔUs7 spread defect (Fig 1B). PRV mutants lacking Us8 (ΔUs8) had a marked reduction of anterograde spread at 24hpi. While the CT of Us7 affects anterograde spread, deletion of the cytoplasmic C-terminal domain of Us8 had little effect on virus spread. By contrast, deletion of the N-terminal ecto-domain (NT) was as defective for anterograde spread as the complete deletion of Us8 (Fig 1C). The spread defects of all Us8 mutants were rescued by AdV transduction of wild-type Us8. As shown previously, ΔUs9 PRV mutants were completely defective in anterograde spread at 24 hrs (Fig 1D). Importantly, the spread defect of ΔUs9 was rescued by AdV transduction with wild-type Us9, but not by transduction of the YY(49,50)AA di-tyrosine Us9 mutant (Us9-YY), consistent with earlier data [27, 28]. We also tested other Us9 mutant proteins in AdV transduction studies for their capacity to complement the spread defect of the complete ΔUs9 mutant. A penta-serine Us9 mutant (Us9-5S) in which five identified phosphorylated serine residues (positions 38, 46, 51, 53, and 59) [17] were substituted with alanine failed to rescue the spread defect of ΔUs9 PRV. Similarly, a truncated Us9 protein that lacked the first 29 residues of the Us9 cytoplasmic N-terminal domain (Us9-N30) showed no complementation, whereas truncation of the first 20 residues (Us9-N21) showed weak complementation (~2 log units).
Anterograde spread of PRV-Us7/Us8 double deletion viruses (ΔUs7-8) was completely abrogated (Fig 1E) and partial AdV trans-complementation was seen only when both proteins were expressed, but not with individual Us7 or Us8 expression. PRV mutants expressing Us7 and Us8 proteins both lacking their cytoplasmic C-termini (ΔUs7-8(CT)) showed an intermediate spread defect, indicating that deleting the cytoplasmic domains of both proteins had neither an additive nor synergistic effect.
Altogether, these data indicate that all three proteins have distinct roles in anterograde spread. For Us7, the relative minor contribution is mediated by the cytoplasmic domain, whereas for Us8, only the ecto-domain is required for efficient anterograde spread. Heterodimer formation of Us7 and Us8, which occurs via their ecto-domains, has been shown to be important for anterograde spread [19].
To confirm the role of the Us7-9 proteins and further test the functionality of the transduced PRV proteins, we used AdV transduction to complement the severe anterograde spread defect of a PRV mutant lacking all three genes (PRV BaBe; ΔUs7-9) (Fig 1F). PRV ΔUs7-9 has spread defects comparable to the parental PRV vaccine strain ‘Bartha’ in vivo and in vitro [22, 28]. AdV expressing Us7, Us8, or both in combination failed to complement the spread defect of PRV ΔUs7-9. However, expressing Us9 alone or in combination with either Us7 or Us8 showed modest complementation. By contrast, expression of all three proteins with AdV restored efficient anterograde spread to PRV ΔUs7-9 as efficiently as complementing single-mutants (Fig 1B–1D and 1F).
Finally, we determined if the homologous Us7-9 proteins of herpes simplex virus 1 (HSV-1) could complement the spread defects of PRV Us7-9 mutants. AdV transduction of all three HSV-1 Us7-9 proteins together were modestly effective in restoring PRV ΔUs7-9 anterograde spread; similar to the extent of complementation of the PRV ΔUs7-9 defect by PRV Us8/Us9. Complementation of the PRV ΔUs7-9 spread defect by single HSV-1 Us8 or Us9 proteins was not observed (S1A Fig). However, we found that the HSV-1 Us7 protein was able to complement the spread defect of the PRV-ΔUs7 virus, but to a much lower extent than the PRV Us7 protein. We note that the HSV-1 wild-type virus had a marked slower anterograde spread phenotype compared to PRV (S1B Fig). Interestingly, only HSV-1 Us7, but not HSV-1 Us8 or Us9, show complementation of the corresponding PRV single mutant virus, however with slow kinetics resembling HSV-1, but not PRV, wild-type.
The kinetics of limited anterograde spread promoted by deletions of Us7, Us8, or Us9
The amount of time taken to spread from axons to epithelial cells is a measure of the extent of axonal sorting and axonal transport of virions in neurons, as well as the timing and extent of axonal egress to the amplifying epithelial cells. To determine the kinetics of limited anterograde spread observed after neuronal infection by PRV mutants with deletions of Us7, Us8, or Us9, we constructed mutants also expressing the mRFP-VP26 capsid fusion protein [29]. This fusion protein enabled us to visualize infection of neurons and indicator cells using whole chamber fluorescence microscopy as well as facilitating tracking of individual particles. We routinely performed time-lapse imaging of infected SCG neuronal cultures continuously from 8–48 hpi (Fig 1G and 1H). PRV wild-type and all tested mutants produced significant red fluorescence in the S compartment at ~10 hpi. Differences in the kinetics of anterograde spread among mutant viruses became apparent when we measured the elapsed time between the appearance of red fluorescence in the S compartment and subsequent detection in epithelial cells in the N compartment (Fig 1H). On average, wild-type PRV took 10 h to spread from the S compartment to the indicator cells in the N compartment. The ΔUs7 mutant took 16 h. For the ΔUs8 mutant, several replicates had detectable spread that was delayed by 10–16 h, and several had no spread visible after 48 h or longer. This finding of a mixed spread phenotype for Us8 mutants is reminiscent of the mixed spread defects for Us8 mutants observed in vivo [30]. Interestingly, the spread defect of the ΔUs7/ΔUs8 double mutant was comparable to one of the two ΔUs8 populations, potentially indicating a stabilization of this phenotype in the ΔUs7/ ΔUs8 double mutant. Furthermore, the intermediate defect indicates that there is no additive or synergistic effect of deleting both proteins. ΔUs9 virus mutants had no detectable spread to epithelial cells (Fig 1H), even up to 72 hpi. All spread defects could be complemented by AdV transduction of wild-type PRV proteins. We also counted the number of fluorescent capsid foci in the N compartment epithelial cells at 36 hpi (Fig 1G and 1I). PRV wild-type and all AdV-complemented conditions resulted in similar counts (>300 foci), as did infection with the ΔUs7 mutant. However, infection with the ΔUs8, ΔUs7/ΔUs8 and ΔUs9 mutants showed a markedly reduced number of foci in the N compartment epithelial cells (0–50). These data indicated that Us7-9 mutations have different effects on the kinetics of anterograde spread. When compared to the spread of wild type PRV, ΔUs9 mutants showed no anterograde spread at all, spread of the ΔUs8 mutant was markedly reduced, and spread of the ΔUs7 mutant showed an intermediate delay.
Analysis of post-translational Us7-9 modifications on anterograde spread
The presence of Us9 protein is critical for anterograde spread, and phosphorylation of Us9 appears to be critical as well. The penta-serine mutation that removes Us9 phosphorylation sites is unable to restore wild type spread kinetics to the ΔUs9 mutant. It has also been established that maturation of the glycoproteins Us7 and Us8 in the Golgi compartment is required for their function [21, 31, 32]. We next analyzed post-translational events by Western blotting of infected cell lysates with mutant strains (Fig 2A). We cultured SCG neurons for two weeks, infected the cultures at a MOI of 10 with PRV wild-type or mutant strains for 6, 12, or 24 h, and analyzed the cell lysates by Western blot. Treatment with the drug Brefeldin A (BrefA), which inhibits ER-to-Golgi trafficking and protein glycosylation at the Golgi [33], served as a control. As previously reported, Us7 maturation did not occur in ΔUs8-infected cells, whereas Us8 maturation was only partially delayed in ΔUs7-infected cells [31]. Of note, cells infected with the ΔUs7(CT) mutant, which lacks the cytoplasmic tail of Us7, exhibited normal Us8 maturation, and cells infected with the ΔUs8(CT) mutant, which lacks the cytoplasmic tail of Us8, exhibited normal Us7 maturation, indicating that the cytoplasmic tails are not required for proper glycoprotein maturation. Importantly, Us9 expression occurred in all Us7 or Us8 mutant infected or BrefA-treated cells, albeit with different kinetics when compared to wild-type PRV infections. We detected Us9 hyper-phosphorylation in non-wild-type conditions. Since BrefA has strong effects on Us7 and Us8 maturation, we also investigated the kinetics of BrefA-induced Golgi disruption on efficiency of anterograde spread (Fig 2B). BrefA was applied only to the S compartment neuronal cell bodies at the indicated times post infection. Early addition of the drug (2.5 hpi) inhibited viral replication as indicated by strongly reduced S compartment titers [32]. Later addition of the drug (5 hpi) had minor effects on replication but essentially eliminated spread to indicator cells in the N compartment. Addition of BrefA to the S compartment at 8.5 hpi resulted in minor replication and spread defects, suggesting that the first progeny particles are sorted into the N compartment and spread to detector cells between 5–8.5 hpi, consistent with our live imaging results (Fig 1H). These results indicate that BrefA treatment affects Us7 and Us8 maturation as well as axonal sorting and anterograde spread late in infection.
Complex formation and motor recruitment occurs at the trans-Golgi network
We next determined if the AdV-transduced proteins maintain the capacity to localize to the Golgi on their own, in the absence of PRV infection (Fig 2C). Confocal imaging of SCG neurons transduced with Us7-mTurquoise2, Us8-mCherry, or GFP-Us9 all show colocalization of the PRV proteins with the Golgi marker GM130. Us8-mCherry most strongly colocalized with GM130, whereas GFP-Us9 also exhibited strong vesicular and plasma membrane localization, and the Us7-mTurquoise2 fusion protein also showed a diffuse signal throughout the soma (S1C Fig). We used super-resolution microscopy to determine if Us8 and Us9 are in close proximity at the Golgi compartment (Fig 2D). We observed weak colocalization between Us8-mCherry and GFP-Us9 at the trans-Golgi compartment (as marked by TGN38) in uninfected cells. However, colocalization was greatly enhanced after infection with wild type PRV Becker [17]. Interestingly, Us8 showed significant colocalization with TGN38 under both conditions. These results indicate that in the course of a wild-type infection, Us8-9 localize to the Golgi, where they are present in close proximity. In fixed cell analysis, we also observed discrete colocalized puncta of AdV-transduced Us7-9 along the axons of uninfected SCG neurons. Subsequent live cell TIRF microscopy of SCG cell cultures grown in Campenot chambers [13], transduced with either Us8-mCherry alone or in combination with Us7-mTurquoise2 and GFP-Us9, revealed the dynamic behavior of these puncta (Fig 2E and 2F). In the axons of uninfected neurons, Us8 alone localized to individual motile vesicles that exhibited bidirectional retrograde and anterograde movements. When Us7 and Us8 were co-expressed, they colocalized in motile vesicles, but exhibited a greater proportion of anterograde movement. When all three proteins, Us7-9 were co-expressed, distinct puncta positive for all three proteins showed the highest percentage of anterograde processive motility. Similar experiments with HSV-1 Us7-9 also revealed that all three viral proteins moved together in the absence of viral infection (S1D Fig). These data indicate that the specific anterograde-only motility pattern observed for PRV egress vesicles [13] is very closely mimicked by the three Us7-9 proteins, even in the absence of infection. They further support results that Us7-9 of HSV-1 and PRV have the capacity to induce anterograde vesicle motility.
Us7-9 form a complex that recruits Kif1a
Given that Us7-9 colocalize at the trans-Golgi network and move together in axons, we attempted to characterize the three-protein complex after infection (Fig 3A). We transduced PK15 cells with AdV encoding Us8-mTurquoise-HA, together with GFP-Us9, or with GFP-Us9 and Us7-mTurquoise-Flag. Cells remained uninfected (mock), or were infected with PRV Becker for 12 hpi, lysates were prepared, and immunoprecipitated with an anti-HA tag antibody. As expected, based on previous reports, Us7 and Us8 form a strong interaction independent of PRV infection. However, we were unable to show an association with Us9 in transduced, but uninfected cells. However, Us9 was clearly present in immunoprecipitates of Us7-9 in PRV-infected samples. Untagged endogenous Us9 and GFP-tagged AdV-transduced Us9 both co-immunoprecipitated with the Us7/Us8 heterodimer. We note that in multiple repeats of this experiment, we were unable to detect cytoplasmic dynein or kinesin motor proteins by co-immunoprecipitation of Us7-9. We next turned to step gradients and co-sedimentation experiments as a gentler approach to identify possible interactions of the Us7-9 complex with motor proteins (Fig 3B). Isolating detergent resistant membranes (DRM) from neuronal cell cultures by gradient ultra-centrifugation enriches for membrane sub-compartments that are phenomenologically related to the concept of “lipid rafts” in cell physiology. Us7-9 are extracted in DRMs, and this correlates with their function in PRV axonal spread [34]. We compared the presence of Kif5 (kinesin-1) and Kif1a (kinesin-3) in DRM fractions of mock, PRV wild-type, or ΔUs9-infected SCG neurons. Kif1a and Kif5 motors drive anterograde transport of cellular axonal cargoes, and both have been reported to be involved in PRV and HSV-1 anterograde transport [17, 35, 36]. In wild-type infected samples, we detected an increase in Kif1a in the DRM fractions compared to mock and ΔUs9-infected conditions, but no enrichment of Kif5. Taken together, this biochemical evidence indicates, that during PRV infection Us7-9 form a tripartite complex (Fig 3A), which has the ability to recruit Kif1a, but not Kif5 or dynein, into DRMs in a Us9-dependent manner. However, the Us7-9 tripartite complex is easily disrupted by standard cell lysis methods.
Kif1a transports PRV and HSV-1 in axons with Us7 playing a critical role in velocity differences
To determine whether Kif1a motor proteins colocalize and co-transport with PRV and HSV-1 particles in axons, we again used live cell TIRF microscopy of SCG neurons grown in Campenot chambers (Fig 3C). SCG neurons were transduced with AdV expressing full-length Kif1a-mNeonGreen (Kif1a-mNG), and co-infected with PRV or HSV-1 recombinants expressing mRFP-VP26 capsid tags (PRV 180 and HSV-OK14). We detected distinct co-translocation of Kif1a with fluorescent capsids expressed by both viruses. Of note, Kif1a-mNG expression varied from cell to cell, but was independent of viral infection. In similar experiments, we were unable to detect co-translocation with a fluorescent protein-tagged kinesin-1 isoform Kif5B (Fig 3D).
To measure virus particle transport, we performed automated single particle tracking to extract particle velocities (Fig 3E–3G). For wild-type PRV, we detected almost exclusively anterograde motility, with a broad distribution of anterograde velocities up to 6 μm/sec [13]. Since we were unable to detect any ΔUs9 particles in axons, we analyzed AdV-complemented ΔUs9 (ΔUs9comp) particle motility only. With AdV transduction to express GFP-Us9, we also observed almost exclusively anterograde motility, albeit with a reduced maximum velocity. One possible explanation for this reduction may be steric hindrance by the GFP tag on the transduced GFP-Us9, or that the quantity and kinetics of AdV transduced Us9 expression does not complement as efficiently as endogenous Us9 expression.
PRV ΔUs7 particles had somewhat reduced maximum velocities, but also the appearance of more retrograde motility. These effects were rescued by AdV transduction of Us7 (ΔUs7comp). This finding suggests that Us7 might play a role in inhibiting cytoplasmic dynein-mediated retrograde transport and accelerating Kif1a motility during anterograde transport. The data also provides a possible explanation for the intermediate spread defect observed for ΔUs7 strains (Fig 1B). In addition, we analyzed a small number of rare motile ΔUs8 particles in the axon. Similar to the ΔUs7 condition, ΔUs8 particles had fewer instances of high velocity anterograde transport, and the appearance of more retrograde motility, which was rescued by AdV transduction of Us8 (ΔUs8comp).
We extended our analyses to HSV-1 capsids in axons (Fig 3F). We observed a single peak of velocity of HSV-1 particles in the anterograde direction, and also a distinct retrograde peak, implying a more extensive contribution of cytoplasmic dynein during axonal transport of HSV-1. These findings provide an explanation of why HSV-1 anterograde spread appears delayed compared to PRV spread in our system. Finally, we investigated the specific contribution HSV-1 Us7 to the slower motility profile of HSV-1 by complementing PRV-ΔUs7 with AdV expressing HSV-1 Us7 (Fig 3G). We detected motile capsids in axons suggesting that HSV-1 Us7 can complement PRV-ΔUs7 (see also S1A Fig). However, these complemented particles showed more retrograde motility and an apparent lack of high anterograde velocities, when compared to the PRV Us7 complementation motility profile. Taken together, these data point to a potential role of PRV Us7 in reducing retrograde, cytoplasmic dynein-mediated transport events and/or contributing to mechanisms that accelerate Kif1a-mediated anterograde transport. Alternatively, since Us7 is part of a tripartite complex with Us8-9, it is possible that these are functions of the Us7-9 complex, and Us7 is required for efficient formation and stabilization of the complex.
Artificial Kif1a recruitment is sufficient to rescue PRV mutants devoid of Us7-9
This report, together with previous publications, has shown that Us7-9 are necessary for recruitment of Kif1a, axonal sorting of PRV particles, and anterograde spread of PRV. To determine whether Kif1a recruitment is sufficient for anterograde sorting, transport, and spread, we constructed a system for drug-inducible Kif1a recruitment to intracellular virus particles, independent of Us9 or Us7-9 (Fig 4A). We modified a previously described drug-inducible motor recruitment system where two protein domains, FKBP and FRB, heterodimerize only in the presence of a membrane-permeable rapamycin analogue [37]. We fused two FKBP heterodimerization domains to the cytoplasmic C-terminus of glycoprotein M (gM-FKBP), a viral membrane protein that is present in the virion envelope and in the surrounding intracellular transport vesicle [38], in PRV ΔUs9 or ΔUs7-9 genetic backgrounds. A construct consisting of Kif1a motor domain tagged with GFP and an FRB heterodimerization domain was expressed in neurons via AdV transduction. Upon addition of the heterodimerizer drug, FKBP and FRB interact, recruiting the FRB-tagged Kif1a motor to the virion egress vesicle containing gM-FKBP (Fig 4A). We found that SCG neurons supported anterograde spread of ΔUs9 mutant PRV only after Kif1a-GFP-FRB transduction and addition of the heterodimerizer drug (Fig 4B). We also observed anterograde spread with a ΔUs7-9 mutant expressing gM-FKBP. These data indicate that artificial Kif1a recruitment to egress vesicles is sufficient for axonal sorting, transport, and anterograde spread, even in the absence of Us7-9. Next, we analyzed the induced motility of ΔUs9 and ΔUs7-9 particles by TIRF microscopy in the presence or absence of the heterodimerizer drug (Fig 4C). Both ΔUs9 and ΔUs7-9 mutants showed anterograde capsid transport after addition of the heterodimerizer drug. Subsequent motility analysis (Fig 4D) indicates slower, but anterograde-only velocities of ΔUs9 particles, whereas ΔUs7-9 particles also exhibited some movement in the retrograde direction. The retrograde motility of ΔUs7-9 particles is consistent with the phenotype of ΔUs7 and ΔUs8 particles (Fig 3E). Overall, these results support a model suggesting that Us9 represents an essential component in the tripartite Kif1a recruitment complex of PRV, which is able to modulate Kif1a speed to higher velocities, and/or reduce the function of slower anterograde and opposing retrograde motors. PRV Us7 and Us8 might also support Us9 in accelerating wild-type Kif1a motors (though not the artificial Kif1a-GFP-FRB motor) and inhibiting retrograde movement mediated by cytoplasmic dynein.
The Kif1a recruitment complex remains associated with egressing particles
Next, we determined if the tripartite Kif1a recruitment complex remains associated with the capsid during transport along the axon (Fig 5A). We transduced SCG neuronal cultures in Campenot chambers with AdV expressing Us7-mTurquoise2 (Us7-mT), Us8-mTurquoise2 (Us8-mT), or GFP-Us9 and infected with the corresponding PRV deletion mutant expressing mRFP-VP26 to label capsids. At 12 hpi, we observed motile progeny capsids using live cell TIRF microscopy. In all conditions, the majority of observed motile particles showed distinct co-location of capsid and envelope proteins along the length of the run. The signal for Us7 and Us8 in the axon was almost exclusively associated with moving capsids, but puncta positive for Us9 were also observed to move independently of capsids. We also observed co-translocation of HSV-1 mRFP-VP26 capsids and AdV-transduced HSV-1 Us7-mTurquoise2 and HSV-1 GFP-Us9 (Fig 5B). Interestingly, HSV-1 GFP-Us9 was almost always associated with motile HSV-1 capsids. These data indicate that the triple complex of Us7-9 is closely associated with PRV and HSV-1 capsids undergoing anterograde transport in the axon of neuronal cells.
Discussion
Here we show how a tripartite complex consisting of the PRV proteins Us7, Us8, and Us9 recruits the kinesin-3 motor protein Kif1a to viral egress vesicles. Kif1a recruitment, via viral Us7-9 proteins, or via an engineered drug-inducible system, is sufficient to sort the virion egress vesicle into the axon, leading to anterograde transport, and spread to epithelial cells. Super-resolution and TIRF microscopy, coupled with motility analysis at high temporal and spatial resolution, indicates that each member of the tripartite complex has distinct functions. We present evidence that Us8 has the strongest capacity to localize to the trans-Golgi network where it presumably recruits Us7 via tight heterodimer formation, leading to subsequent Us7 maturation. Us9 can localize to the Golgi independently of Us7/Us8 or full PRV infection. In order to function in axonal sorting and transport, the Us9 protein must be present at the trans-Golgi network, likely phosphorylated at critical serine residues, and form a tripartite complex with Us7 and Us8, potentially via the C-terminal domain of Us7. Since egress from cell bodies (not axons) occurs efficiently in the absence of Us9, and only a minority of egress vesicles sort into the axon late in infection, the kinetics of Kif1a-recruitment are not yet clear. The specific complex of Us9 with Us7 and Us8 may form only in a subset of secondary envelopment sites or egress vesicles [39], which are then destined to recruit Kif1a and be sorted to the axon. Based on the existence of fast-moving vesicular structures positive for Us7-9 in axons of uninfected SCG neurons, Kif1a recruitment does not appear to require any additional viral factors aside from the Us7-9 complex itself. However, we find that HSV-1 Us7-9 are generally not capable of trans-complementing PRV ΔUs7-9 mutants, so other viral factors may be required for efficient localization to sites of secondary envelopment and incorporation into virion secretory vesicles.
All tested viral envelope proteins, as well as the Kif1a motor protein, remain tightly associated with the capsid during anterograde axonal transport, and can be observed along the entire length of the axon. Given the long run length of individual particles, we conclude that the dissociation rate of the Us7-9 recruitment complex and the motor protein is low. This conclusion is further supported through our biochemical evidence of a Us9-dependend Kif1a recruitment to “lipid raft” like membrane structures and through the motility analysis of engineered heterodimer-induced capsid transport. The FKBP-FRB interaction has a half-life of ~18 h, and the resulting motility resembles wild-type particles, in that it is anterograde-only. It remains unclear why the heterodimer-induced capsid structures do not have higher velocity runs (Fig 4D). Possibly, the lack of Us9 keeps the Kif1a motor operating at a lower velocity. Alternatively, the truncated Kif1a-GFP-FRB construct used for these experiments may move with a slower maximum velocity in general. Additionally, AdV transduction might not confer complete complementation, as may also be the case with ΔUs9 complementation by AdV-transduced GFP-Us9 (Fig 3E). The role of Us8 appears to be in the initiation of stable complex formation at the trans-Golgi network via heterodimerization with Us7. Anterograde spread does not depend on the Us8 cytoplasmic domain, which rules it out as a likely contact interface with Us9 or Kif1a. However, potential interactions via the trans-membrane domains of the proteins cannot be ruled out. It is clear that the Us8 ecto-domain is critical for spread in vitro and in vivo [19, 40], which is presumably due to Us7 binding [31]. In this study, we found two potential roles for Us7. One is that Us7 may inhibit cytoplasmic dynein on transport vesicles and the other is that Us7 in complex with Us8 and US9 may modulate Kif1a acceleration. Such activities for Us7 may explain why wild-type HSV-1 progeny particles exhibit some retrograde motility in axons. Wild-type HSV-1, or ΔUs7 PRV trans-complemented with HSV-1 Us7, exhibit some retrograde, minus-end directed velocities. Therefore, HSV-1 Us7 may lack the capacity to inhibit cytoplasmic dynein. As a result, HSV-1 has slower anterograde spread kinetics than PRV, moving slower anterogradely inside the axon during egress. It appears that Us7 in both alpha-herpesviruses, PRV and HSV-1, represents a critical factor that determines the kinetics of anterograde spread. The difference in Us7-mediated egress kinetics may indicate a host-specific divergence as alpha-herpesviruses have evolved to infect hosts of varying sizes and at different anatomical sites, which may require faster anterograde transport with less of a retrograde component. It will be interesting to compare PRV and HSV-1 axonal transport to that of other alpha-herpesviruses with different evolutionary histories.
Our results indicate that both PRV and HSV-1 use a robust Kif1a recruitment mechanism for efficient axonal sorting and transport. We directly tagged the full-length Kif1a motor protein and showed co-transport in axons of individual PRV and HSV-1 proteins on egressing PRV and HSV-1 particles (Fig 3C). Previous studies have implicated other kinesin motors, or Us9-independent motor recruitment mechanisms, but these studies have important limitations. Reports on very rare Us9-independent axonal transport events of PRV particles and their motility analysis in chicken neurons grown in non-compartmentalizes plates [41] were potentially affected by late entering virions [13]. Diefenbach et al. [35] observed interactions between truncated fragments of kinesin-1 Kif5 and HSV-1 Us9 but did not test this interaction in a more physiological context. Mutants of the putative Us9 kinesin binding motif in HSV-1 eliminated kinesin binding, but not axonal transport, suggesting that mutated HSV-1 is still capable of recruiting motors. More recently, DuRaine et al. [36] observed colocalization between HSV-1 particles and cellular cargoes that are typically transported by kinesin-1 in uninfected cells. However, virus infected cells have altered intracellular membrane trafficking and motor recruitment pathways rendering comparisons problematic. The authors also performed RNAi knockdown experiments of kinesin motors but did not quantify the degree of transcript or protein knockdown, making the results difficult to interpret. For PRV, recruitment of Kif1a appears to be necessary and sufficient to guide progeny capsids in enveloped structures into the axon. Other motors may contribute to axonal motility (e.g. the slower and retrograde velocities that we observe may be due to the influence of other motors), but these motors recruited in the absence of Us7-9 are not sufficient for particles to traffic into axons. Recruitment of Kif1a motor protein is required only for axonal sorting and subsequent axonal transport. This interaction is not essential for transport and egress of virus particles from non-neuronal cells. We speculate that interactions between the Us9 cytoplasmic tail, Us7, and Kif1a represent potential targets to block viral transport and spread in axons, even after viral replication has been initiated. In addition, these findings have implications for understanding of axonal sorting of cellular cargoes in uninfected cells and underscore the importance of motor recruitment in axonal sorting.
Materials and methods
Cell lines
Cell lines used for this study, including human 293FT cells (Invitrogen), rat2 cells (ATCC #CRL-1764), African green monkey kidney epithelial cells (VERO, ATCC #CCL-81), and porcine kidney epithelial cells (PK15, ATCC# CCL-33), were maintained in DMEM (HyClone) supplemented with 10% FBS (HyClone) at 37°C and 5% CO2.
PRV and HSV-1 recombinant viruses
Alpha-herpesvirus strains used in this study are summarized in Table 1. PRV Becker and HSV-1 17+ were used as wild-type strains. All virus titers were determined by serial dilution plaque assays on PK15 cells for PRV strains or VERO cells for HSV strains, and predicted Us7-9 gene expression was confirmed by Western blotting of virus infected cell lysates.
PRV strains PRV740, PRV741, and PRV742 were constructed by co-infection of PRV180, expressing an mRFP-VP26 capsid tag, with PRV98 (Us7 null), PRV99 (Us7/Us8 null), and PRV107 (Us8-CT deletion), respectively. Resulting plaques were screened for gain of mRFP-VP26 capsid fluorescence.
PRV1020 and PRV1021 were generated as follows: PRV437 contains a Us9-null mutation and a gM-mCherry fusion, as previously described [47]. Shuttle plasmid pSB25 (provided by L. Pomeranz, S. Bratman, and L. Enquist) contains the PRV UL10 gene, encoding glycoprotein M, with a C-terminal EGFP fusion. Plasmid pßactin-PEX3-mRFP-FKBP was a kind gift from C. Hoogenraad (Utrecht U., Netherlands) [37]. The 2xFKBP domains from pβactin-PEX3-mRFP-FKBP were amplified by PCR and ligated into pSB25 using SphI/AleI restriction sites, replacing EGFP. The resulting gM-FKBP fusion junctions are as follows (C-terminal gM sequence is in bold type, peptide linkers are italicized, 2xFKBP sequence is in plain type, and stop codon indicated with an asterisk): …EVVYENLGFEMVSKGEELFTDRGVQVETISP…FDVELLKLETSYLYK*
The gM-FKBP shuttle plasmid was co-transfected with PRV437 nucleocapsid DNA, and plaques were screened for the loss of gM-mCherry fluorescence, producing a cloning intermediate, PRV1024. A shuttle plasmid encoding mCherry-VP26 capsid fusion [48] was co-transfected with PRV1024 nucleocapsid DNA, and plaques were screened for gain of mCherry capsid fluorescence. The resulting PRV1020 expresses an mCherry-VP26 capsid tag, gM-FKBP fusion protein, and contains a US9-null mutation. PRV BaBe consists of wild-type PRV Becker with the Bartha Us region containing a deletion that disrupts genes Us7, Us8, Us9, and Us2. Using the same procedure described above we also introduced the mCherry-VP26 capsid tag and gM-FKBP fusion protein into PRV BaBe, producing PRV1021.
Adenovirus vectors
The adenovirus vectors expressing GFP-Us9 and Us8-mCherry were previously described [17, 49]. Adenovirus vectors expressing herpesvirus Us7 (gI) or Us8 (gE) were constructed by PCR amplification of the coding sequence from PRV strain Becker or HSV strain 17. PRV Us9 wild-type and mutant genes were synthesized (Genscript, Piscataway, NJ). The cellular gene Kif1A was PCR amplified from rat cDNA. Similarly, GFP-Kif5B was PCR amplified from previously described plasmids [50]. The plasmid pβactin-KIF1A(1–489)-GFP-FRB was a kind gift from C. Hoogenraad (Utrecht U., Netherlands) [37]. All genes of interest were cloned into pAd/CMV/V5-DEST by Gateway recombination (Invitrogen). The completed vectors were confirmed by DNA sequencing. All adenovirus vectors were propagated on complementing 293FT cells, cell-associated virus was harvested in serum-free DMEM, and the transduction efficiency of the resulting stocks was estimated by visualizing fluorescent protein expression in rat2 cells. Cell lines were generally transduced for 24 hours.
Culture of primary neuronal cells
Neurons of embryonic rat superior cervical ganglia (SCG) were isolated and cultured as previously described [13]. Briefly, SCGs were dissected from embryonic day 17 (E17) Sprague-Dawley rat embryos (Hilltop Labs Inc., Pittsburgh, PA) and then plated and maintained in neuronal medium consisting of Neurobasal medium (Invitrogen) supplemented with 1% penicillin-streptomycin with 2 mM glutamine (Invitrogen), 2% B27 (Invitrogen), and 100 ng/ml NGF (NB+ medium). Plates were either 35mm plastic dishes (Fisher Scientific, Allentown, PA) for spread experiments, or for live cell analysis MatTek glass-bottom (Ashland, MA) or plastic-bottom (IBIDI, Madison, WI) dishes, all pre-coated before cell plating with 500 μg/ml of poly-DL-ornithine (Sigma-Aldrich, St. Louis, MO) for 24 h at 37°C and 10 μg/ml of natural murine laminin (Invitrogen) for at least 12 h at 37°C.
Plastic dishes were further prepared for chambered SCG cultures, to separate axon extensions from cell bodies, by mounting modified Campenot chambers (Fig 1A). A series of parallel grooves were etched across the surface and covered with 1% methylcellulose in DMEM. A CAMP320 three-chambered Teflon ring (Tyler Research; Edmonton, Alberta, Canada) was then coated with vacuum grease on one side and placed on top of the tissue culture surface, oriented such that the grooves extended across all three compartments. To kill non-neuronal dividing cells, 48 h after SCG cell plating, 1 mM cytosine-D-arabinofuranoside (Sigma-Aldrich) was added for 2 days. All SCG cultures were allowed to differentiate for at least 14 days prior to infection.
All animal work was performed in accordance with the Princeton Institutional Animal Care and Use Committee (protocol #1947).
Anterograde spread assay and herpesvirus infections
Chambered SCG cultures were transduced in the soma compartment with adenovirus vectors 2–3 days prior to herpesvirus infections. Transduction efficiency of vectors was checked by fluorescence microscopy to be >95% before 105 indicator cells were plated in the neurite compartment and 1% methocel in NB+ medium was added to the middle compartment to further prevent medium exchange between chambers. Chambered SCG cultures were inoculated in the S compartment with either PRV or HSV with 106 pfu (~MOI of 50) to achieve synchronized infections. To determine titers, soma and neurite chamber media were harvested 24 hours post-infection (hpi), if not stated otherwise. Live microscopy of entire chambers was initiated between 6–8 hpi and lasted up to 72 h. Dissociated SCG cultures were also infected with 106 pfu (~MOI of 50) in a small volume of NB+ medium.
PRV titers were determined by plaque assay on PK15 cells overlaid with 1% methocel in DMEM containing 2% FBS, whereas VERO cells were used for HSV strains. Brefeldin A (BrefA) was purchased from Sigma-Aldrich (B7651) and added to the cells at a concentration of 5 μg/ml.
Biochemical methods, western blotting, and antibodies
Detergent resistant membrane (DRM) fractions were isolated by Optiprep sucrose gradient centrifugation as previously described [34]. Briefly, ~106 SCG neuronal cells were either mock infected or infected at MOI = 10 with PRV Becker or PRV 161. At 12 hpi, cells were collected in a 50 ml conical tube, and washed twice with cold RPMI medium by brief centrifugation at 3,000 rpm. Cells were lysed with 1 ml of lysis buffer consisting of 1% TX-100 in TNE buffer (25 mM Tris HCl [pH 6.8], 150 mM NaCl, 5 mM EDTA), protease inhibitor cocktail (Roche Diagnostics GmbH, Mannheim, Germany), and 5 mM iodoacetamide. The lysate was homogenized by being passed 15 times through an 18-gauge needle, and then allowed to rock for 30 minutes at 4°C. At the end of the rocking period, the sample was again homogenized briefly, and then mixed with 2 ml of ice-cold 60% Optiprep density gradient medium (Sigma-Aldrich). The entire 3 ml mixture was placed at the bottom of a Beckman SW41 ultracentrifuge tube (Beckman, Munich, Germany) and subsequently overlaid with 5 ml of ice-cold 30% Optiprep in TNE and 4 ml of ice-cold 5% Optiprep in TNE. Samples were centrifuged at 34,200 rpm (200,000×g) at 4°C for 20 hours. Twelve fractions were collected from the top to the bottom of the tube (1 ml each), and processed for immunoblotting. For direct cell lysate analysis or immunoprecipitations, cells were lysed after two washes twice with PBS (HyClone) and one wash with radioimmunoprecipitation assay (RIPA) buffer (10 mM TrisHCl, 150 mM NaCl, 1 mM EDTA, and 1 mM EGTA, pH7.4). Samples were then taken up in RIPA, kept on ice for 15 min, centrifuged at 13,200 rpm at 4°C, transferred into new tubes and either immediately processed for immunoblotting or incubated for coimmunoprecipitations with monoclonal anti-HA antibodies linked to Sepharose A beads at 4°C for 1.5 h and washed, and the bound (pellet) fractions were analyzed by immunoblotting. Samples were heated in Laemmli buffer at 100°C for 5min before proteins were separated on gradient polyacrylamide gels (4–12%, NuPage, Invitrogen), which were run at 175V for 50min. Proteins were transferred onto a PVDF membrane (0.45 μm pore size, Immobilon-P, Millipore) using semidry transfer (Biorad). After transfer, membranes were incubated in 5% non-fat dry milk in PBST (PBS + 0.1% Tween-20) solution for 1 h at room temperature. Immunoblots were performed using primary and secondary antibodies in 5% milk PBST solution. Membranes were incubated with chemiluminescent substrates (Supersignal West Pico or Dura, Thermo scientific). Protein bands were visualized by exposure on HyBlot CL (Denville scientific) blue X-ray films.
Antibodies used in this study included a monoclonal anti-GM130, anti-TGN38 (both from BD Transduction Laboratories), anti-Kif5 (MAP1614, Chemicon), anti-β-actin (Sigma-Aldrich), anti-transferrin receptor (TfR, Zymed, San Francisco, CA), pooled anti-PRV-gE (kind gift from T. Ben-Porat) and phospho-specific Us9 antibody 2D5E6 [20]. Rabbit antibodies included anti-Kif1a (HPA004831 & HPA005442, Sigma-Aldrich), anti-Us9 [22], anti-PRV-gI and anti-PRV-gE (generous gifts from K. Bienkowska-Szewczyk) and goat anti-PRV-gB (284) and anti-PRV-gI proteins were described elsewhere [51].
Microscopy and analysis of capsid motility
For fixed cell microscopy, dissociated SCG neurons were grown on MatTek dishes (Ashland, MA) for 2 weeks prior to imaging. Upon transduction with adenovirus constructs, cells were fixed in a 4% paraformaldehyde-PBS solution for 10 minutes at room temperature followed by two PBS washes. Prior to antibody staining, samples were permeabilized with 0.05% Triton-X in PBS for 10 min at RT followed a PBS wash and blocked with 3% BSA-PBS solution for 1hr at RT followed by five PBS washes. Samples were stained with anti-GM130 antibody raised in rabbit (Ab52649) at 1:750 dilution followed by 2X PBS washes, then incubated with Alexa-546 secondary antibody for 1hr RT followed by a final wash in PBS. For confocal microscopy, images were acquired on a Nikon A1 confocal microscope with a Nikon 60x oil objective (NA = 1.4). For super-resolution microscopy, 3D structured illumination microscopy (3D-SIM) was performed using a Nikon N-SIM. All data for 3D-SIM were captured used a Nikon CFI Apo TIRF (100× 1.49 NA oil objective). 3D-SIM image stacks were sectioned using a 250 nm z-step size. Raw image data were reconstructed and analyzed using Nikon Elements software.
Live anterograde spread in chambered SCG cultures was imaged using a Nikon Ti-Eclipse inverted epifluorescence microscope (Nikon Instruments, Melville, NY) equipped with a separate fast-switching excitation and emission filter wheels (Prior Scientific, Rockland, MA) and a heated cell culture chamber (Ibidi) to ensure biologically relevant environmental conditions during image acquisition. Images were acquired every two hours with a CoolSnap ES2 charge-coupled device (CCD) camera (Photometrics, Tucson, AZ) and a Nikon Plan Fluor PhlDlWD 4× (N.A. 0.13) objective (Nikon Instruments) in large image mode covering the entire chamber.
For microscopy of axonal transport in neuronal cells, we used high resolution dual-color imaging on an inverted Nikon Ti-Eclipse TIRF microscope equipped with an Agilent laser source (Agilent) producing approximately 65 mW of 488-nm and 561-nm light at the fiber exit, an Nikon APO TIRF 100× (N.A. 1.49) objective, and an iXon Ultra EM-CCD camera (Andor Technology, South Windsor, CT), run through Nikon NIS AR software (Princeton University Molecular Biology Confocal Microscopy Facility). Lasers at 405, 488, and 561 nm were used at no more than 30% of their maximal output and allowed trigger acquisition at a frame rate of 18.7 fps (two colors) or 15.7 fps (three colors) with 25 nm spatial resolution.
Particle tracking and motility analysis was performed as described earlier for adenovirus [52], but modified for alpha-herpesviruses [13]. Briefly, a custom-tracking algorithm was used to extract the position of virus particles as a function of time. All fluorescent particles were fit to 2-D Gaussian profiles and treated as coming from a diffraction-limited point source. Positions of each particle were obtained from the Gaussian fits. Trajectories were reconstructed by matching particle locations based on their displacements between frames. To limit contributions of rare but long non-motile particle tracks as well as to reduce the relative contribution of very long pauses, parts of tracks with asymmetry parameter below 1.0 (±25-point window) were eliminated from analysis. Trajectories were then automatically parsed into segments of constant velocity. Previously published analyses focused on motile events longer than 400–500 nm. To mimic this, velocities were analyzed for long segments above the standard motility cut-off only (2σ value of the zero-centered peak in segment length distribution). The cut-off was usually in the range of two to four capsid diameters (300–600 nm). All segments above the cut-off were used to assemble segment length histograms with decay curve fits.
Ethics statement
All animal work was conducted in accordance with the Princeton Institutional Animal Care and Use Committee (protocol # 1947). All personnel adhered to applicable federal, state, local, and institutional laws and policies governing ethical animal research. This includes the Animal Welfare Act (AWA), the Public Health Service Policy on Humane Care and Use of Laboratory Animals, the Principles for the Utilization and Care of Vertebrate Animals Used in Testing, Research and Training, and the Health Research Extension Act of 1985.
Supporting information
Zdroje
1. Black MM, Baas PW. The basis of polarity in neurons. Trends Neurosci. 1989;12(6):211–4. doi: 10.1016/0166-2236(89)90124-0 2473556
2. Foletti DL, Prekeris R, Scheller RH. Generation and maintenance of neuronal polarity: mechanisms of transport and targeting. Neuron. 1999;23(4):641–4. doi: 10.1016/s0896-6273(01)80022-2 10482230
3. Banker G. The Development of Neuronal Polarity: A Retrospective View. J Neurosci. 2018;38(8):1867–73. doi: 10.1523/JNEUROSCI.1372-16.2018 29467146
4. Chevalier-Larsen E, Holzbaur EL. Axonal transport and neurodegenerative disease. Biochim Biophys Acta. 2006;1762(11–12):1094–108. doi: 10.1016/j.bbadis.2006.04.002 16730956
5. Baas PW, Lin S. Hooks and comets: The story of microtubule polarity orientation in the neuron. Dev Neurobiol. 2011;71(6):403–18. doi: 10.1002/dneu.20818 21557497
6. Hirokawa N, Noda Y, Tanaka Y, Niwa S. Kinesin superfamily motor proteins and intracellular transport. Nat Rev Mol Cell Biol. 2009;10(10):682–96. doi: 10.1038/nrm2774 19773780
7. Bentley M, Banker G. The cellular mechanisms that maintain neuronal polarity. Nat Rev Neurosci. 2016;17(10):611–22. doi: 10.1038/nrn.2016.100 27511065
8. Goldstein LS, Yang Z. Microtubule-based transport systems in neurons: the roles of kinesins and dyneins. Annu Rev Neurosci. 2000;23:39–71. doi: 10.1146/annurev.neuro.23.1.39 10845058
9. Leterrier C, Dargent B. No Pasaran! Role of the axon initial segment in the regulation of protein transport and the maintenance of axonal identity. Semin Cell Dev Biol. 2014;27:44–51. doi: 10.1016/j.semcdb.2013.11.001 24239676
10. Huang CY, Rasband MN. Axon initial segments: structure, function, and disease. Ann N Y Acad Sci. 2018;1420(1):46–61. doi: 10.1111/nyas.13718 29749636
11. Smith G. Herpesvirus transport to the nervous system and back again. Annu Rev Microbiol. 2012;66:153–76. doi: 10.1146/annurev-micro-092611-150051 22726218
12. Koyuncu OO, Hogue IB, Enquist LW. Virus infections in the nervous system. Cell Host Microbe. 2013;13(4):379–93. doi: 10.1016/j.chom.2013.03.010 23601101
13. Scherer J, Yaffe ZA, Vershinin M, Enquist LW. Dual-color Herpesvirus Capsids Discriminate Inoculum from Progeny and Reveal Axonal Transport Dynamics. J Virol. 2016.
14. Smith GA. Assembly and Egress of an Alphaherpesvirus Clockwork. Adv Anat Embryol Cell Biol. 2017;223:171–93. doi: 10.1007/978-3-319-53168-7_8 28528444
15. Hellberg T, Passvogel L, Schulz KS, Klupp BG, Mettenleiter TC. Nuclear Egress of Herpesviruses: The Prototypic Vesicular Nucleocytoplasmic Transport. Adv Virus Res. 2016;94:81–140. doi: 10.1016/bs.aivir.2015.10.002 26997591
16. Scherer J, Enquist LW. Alphaherpesviruses: parasites of the peripheral nervous system. Future Virology. 2017;12(10).
17. Kramer T, Greco TM, Taylor MP, Ambrosini AE, Cristea IM, Enquist LW. Kinesin-3 mediates axonal sorting and directional transport of alphaherpesvirus particles in neurons. Cell Host Microbe. 2012;12(6):806–14. doi: 10.1016/j.chom.2012.10.013 23245325
18. Kramer T, Enquist LW. Directional spread of alphaherpesviruses in the nervous system. Viruses. 2013;5(2):678–707. doi: 10.3390/v5020678 23435239
19. Kratchmarov R, Kramer T, Greco TM, Taylor MP, Ch'ng TH, Cristea IM, et al. Glycoproteins gE and gI are required for efficient KIF1A-dependent anterograde axonal transport of alphaherpesvirus particles in neurons. J Virol. 2013;87(17):9431–40. doi: 10.1128/JVI.01317-13 23804637
20. Kratchmarov R, Taylor MP, Enquist LW. Role of Us9 phosphorylation in axonal sorting and anterograde transport of pseudorabies virus. PLoS One. 2013;8(3):e58776. doi: 10.1371/journal.pone.0058776 23527020
21. Whealy ME, Card JP, Robbins AK, Dubin JR, Rziha HJ, Enquist LW. Specific pseudorabies virus infection of the rat visual system requires both gI and gp63 glycoproteins. J Virol. 1993;67(7):3786–97. 8389905
22. Brideau AD, Banfield BW, Enquist LW. The Us9 gene product of pseudorabies virus, an alphaherpesvirus, is a phosphorylated, tail-anchored type II membrane protein. J Virol. 1998;72(6):4560–70. 9573219
23. Lyman MG, Feierbach B, Curanovic D, Bisher M, Enquist LW. Pseudorabies virus Us9 directs axonal sorting of viral capsids. J Virol. 2007;81(20):11363–71. doi: 10.1128/JVI.01281-07 17686845
24. Tomishima MJ, Enquist LW. A conserved alpha-herpesvirus protein necessary for axonal localization of viral membrane proteins. J Cell Biol. 2001;154(4):741–52. doi: 10.1083/jcb.200011146 11502759
25. Tomishima MJ, Smith GA, Enquist LW. Sorting and transport of alpha herpesviruses in axons. Traffic. 2001;2(7):429–36. doi: 10.1034/j.1600-0854.2001.020701.x 11422937
26. Ch'ng TH, Enquist LW. Efficient axonal localization of alphaherpesvirus structural proteins in cultured sympathetic neurons requires viral glycoprotein E. J Virol. 2005;79(14):8835–46. doi: 10.1128/JVI.79.14.8835-8846.2005 15994777
27. Brideau AD, Card JP, Enquist LW. Role of pseudorabies virus Us9, a type II membrane protein, in infection of tissue culture cells and the rat nervous system. J Virol. 2000;74(2):834–45. doi: 10.1128/jvi.74.2.834-845.2000 10623746
28. Taylor MP, Kramer T, Lyman MG, Kratchmarov R, Enquist LW. Visualization of an alphaherpesvirus membrane protein that is essential for anterograde axonal spread of infection in neurons. MBio. 2012;3(2).
29. del Rio T, Ch'ng TH, Flood EA, Gross SP, Enquist LW. Heterogeneity of a fluorescent tegument component in single pseudorabies virus virions and enveloped axonal assemblies. J Virol. 2005;79(7):3903–19. doi: 10.1128/JVI.79.7.3903-3919.2005 15767393
30. Tirabassi RS, Enquist LW. Mutation of the YXXL endocytosis motif in the cytoplasmic tail of pseudorabies virus gE. J Virol. 1999;73(4):2717–28. 10074118
31. Tirabassi RS, Enquist LW. Role of the pseudorabies virus gI cytoplasmic domain in neuroinvasion, virulence, and posttranslational N-linked glycosylation. J Virol. 2000;74(8):3505–16. doi: 10.1128/jvi.74.8.3505-3516.2000 10729124
32. Whealy ME, Card JP, Meade RP, Robbins AK, Enquist LW. Effect of brefeldin A on alphaherpesvirus membrane protein glycosylation and virus egress. J Virol. 1991;65(3):1066–81. 1847436
33. Lippincott-Schwartz J, Glickman J, Donaldson JG, Robbins J, Kreis TE, Seamon KB, et al. Forskolin inhibits and reverses the effects of brefeldin A on Golgi morphology by a cAMP-independent mechanism. J Cell Biol. 1991;112(4):567–77. doi: 10.1083/jcb.112.4.567 1847146
34. Lyman MG, Curanovic D, Enquist LW. Targeting of pseudorabies virus structural proteins to axons requires association of the viral Us9 protein with lipid rafts. PLoS Pathog. 2008;4(5):e1000065. doi: 10.1371/journal.ppat.1000065 18483549
35. Diefenbach RJ, Davis A, Miranda-Saksena M, Fernandez MA, Kelly BJ, Jones CA, et al. The Basic Domain of Herpes Simplex Virus 1 pUS9 Recruits Kinesin-1 To Facilitate Egress from Neurons. J Virol. 2016;90(4):2102–11. doi: 10.1128/JVI.03041-15 26656703
36. DuRaine G, Wisner TW, Howard P, Johnson DC. Kinesin-1 Proteins KIF5A, -5B, and -5C Promote Anterograde Transport of Herpes Simplex Virus Enveloped Virions in Axons. J Virol. 2018;92(20).
37. Kapitein LC, Schlager MA, van der Zwan WA, Wulf PS, Keijzer N, Hoogenraad CC. Probing intracellular motor protein activity using an inducible cargo trafficking assay. Biophys J. 2010;99(7):2143–52. doi: 10.1016/j.bpj.2010.07.055 20923648
38. Hogue IB, Bosse JB, Hu JR, Thiberge SY, Enquist LW. Cellular mechanisms of alpha herpesvirus egress: live cell fluorescence microscopy of pseudorabies virus exocytosis. PLoS Pathog. 2014;10(12):e1004535. doi: 10.1371/journal.ppat.1004535 25474634
39. DuRaine G, Wisner TW, Howard P, Williams M, Johnson DC. Herpes Simplex Virus gE/gI and US9 Promote both Envelopment and Sorting of Virus Particles in the Cytoplasm of Neurons, Two Processes That Precede Anterograde Transport in Axons. J Virol. 2017;91(11).
40. Husak PJ, Kuo T, Enquist LW. Pseudorabies virus membrane proteins gI and gE facilitate anterograde spread of infection in projection-specific neurons in the rat. J Virol. 2000;74(23):10975–83. doi: 10.1128/jvi.74.23.10975-10983.2000 11069992
41. Daniel GR, Sollars PJ, Pickard GE, Sith GA. Pseudorabies Virus Fast Axonal Transport Occurs by a pUS9-Independent Mechanism. J Virol. 2015; 89(15): 8088–8091. doi: 10.1128/JVI.00771-15 25995254
42. Becker CH. Zur primären Schädigung vegetativer Ganglien nach Infektion mit dem Herpes suis Virus bei verschiedenen Tierarten. Experientia. 1967;23:209–217. doi: 10.1007/bf02136291 4293480
43. Bartha A. Experimental reduction of virulence of Aujesky's disease virus. Magny Allatorvosok Lapja. 1961;16:42–45.
44. Card JP, Whealy ME, Robbins AK, Enquist LW. Pseudorabies virus envelope glycoprotein gI influences both neurotropism and virulence during infection of the rat visual system. J Virol. 1992;66:3032–3041. 1313916
45. Brown SM, Ritchie DA, Subak-Sharpe JH. Genetic studies with herpes simplex virus type 1. The isolation of temperature-sensitive mutants, their arrangement into complementation groups and recombination analysis leading to a linkage map. J Gen Virol. 1973;18:329–346. doi: 10.1099/0022-1317-18-3-329 4348796
46. Song R, Koyuncu OO, Greco TM, Diner BA, Cristea IM, Enquist LW. Two modes of the axonal interferon response limit alphaherpesvirus neuroinvasion. mBio. 2016;7(1):e02145–15. doi: 10.1128/mBio.02145-15 26838720
47. Kratchmarov R, Enquist LW, Taylor MP. Us9-Independent Axonal Sorting and Transport of the Pseudorabies Virus Glycoprotein gM. J Virol. 2015;89(12):6511–4. doi: 10.1128/JVI.00625-15 25833054
48. Hogue IB, Bosse JB, Engel EA, Scherer J, Hu JR, Del Rio T, et al. Fluorescent Protein Approaches in Alpha Herpesvirus Research. Viruses. 2015;7(11):5933–61. doi: 10.3390/v7112915 26610544
49. Hogue IB, Scherer J, Enquist LW. Exocytosis of Alphaherpesvirus Virions, Light Particles, and Glycoproteins Uses Constitutive Secretory Mechanisms. MBio. 2016;7(3).
50. Zhou J, Scherer J, Yi J, Vallee RB. Role of kinesins in directed adenovirus transport and cytoplasmic exploration. PLoS Pathog. 2018; 14(5): e1007055. doi: 10.1371/journal.ppat.1007055 29782552
51. Tirabassi RS, Enquist LW. Role of envelope protein gE endocytosis in the pseudorabies virus life cycle. J Virol. 1998;72(6):4571–9. 9573220
52. Scherer J, Yi J, Vallee RB. PKA-dependent dynein switching from lysosomes to adenovirus: A novel form of host-virus competition. J Cell Biol. 2014;205(2):163–77. doi: 10.1083/jcb.201307116 24778311
Článek vyšel v časopise
PLOS Pathogens
2020 Číslo 1
- Ukažte mi, jak kašlete, a já vám řeknu, co vám je
- Prof. Jan Škrha: Metformin je bezpečný, ale je třeba jej bezpečně užívat a léčbu kontrolovat
- FDA varuje před selfmonitoringem cukru pomocí chytrých hodinek. Jak je to v Česku?
- Ibuprofen jako alternativa antibiotik při léčbě infekcí močových cest
- 19. kongres Praktického lékárenství: nové směry, výzvy a příležitosti pro farmaceuty
Nejčtenější v tomto čísle
- Chromatin maturation of the HIV-1 provirus in primary resting CD4+ T cells
- Broad dengue neutralization in mosquitoes expressing an engineered antibody
- Structures of immature EIAV Gag lattices reveal a conserved role for IP6 in lentivirus assembly
- Correction: Interactome analysis of the lymphocytic choriomeningitis virus nucleoprotein in infected cells reveals ATPase Na+/K+ transporting subunit Alpha 1 and prohibitin as host-cell factors involved in the life cycle of mammarenaviruses
Zvyšte si kvalifikaci online z pohodlí domova
Současné možnosti léčby obezity
nový kurzVšechny kurzy